DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and LPL

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_000228.1 Gene:LPL / 4023 HGNCID:6677 Length:475 Species:Homo sapiens


Alignment Length:359 Identity:79/359 - (22%)
Similarity:135/359 - (37%) Gaps:78/359 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QAAKATQNDTLAHQQRIKY-DAQKTMKVMFYKNNTKTMETSAYDDAYDLSG-----SGC--SPTD 93
            |:..|::....|..||..: |.:.       |...:|.|.:|.|..:.:.|     :.|  :.:.
Human    16 QSLTASRGGVAAADQRRDFIDIES-------KFALRTPEDTAEDTCHLIPGVAESVATCHFNHSS 73

  Fly    94 KFAIVLHGW-IQSCSDEWALSLIERLSYYR--GGCVICIDYSVVASSSYMRLYTNFDTLTGAISS 155
            |..:|:||| :....:.|...|:..| |.|  ...||.:|:...|...| .:...:..|.|...:
Human    74 KTFMVIHGWTVTGMYESWVPKLVAAL-YKREPDSNVIVVDWLSRAQEHY-PVSAGYTKLVGQDVA 136

  Fly   156 IILTLFRQGFD-P-KRGYMFGFSFGGQLASAVGRSLRPHHIIESIDTCDMAGPGF---------- 208
            ..:....:.|: | ...::.|:|.|...|...| || .:..:..|...|.|||.|          
Human   137 RFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAG-SL-TNKKVNRITGLDPAGPNFEYAEAPSRLS 199

  Fly   209 ----DPIAVDHS-------------KAGKHVQCFHSSRDKGTFVYSCHRNI-----MLGSCGLKQ 251
                |.:.|.|:             |...||..:.:.   |||...|  ||     ::...||..
Human   200 PDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNG---GTFQPGC--NIGEAIRVIAERGLGD 259

  Fly   252 PSVASQLHLGSHGLCVDIYINTF---DYPFYAVNYTPPE------CFTWQKTAKIPDGYTVGYEE 307
               ..||...||...:.::|::.   :.|..|...:..|      |.:.:|..    ...:|||.
Human   260 ---VDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNR----CNNLGYEI 317

  Fly   308 N-FDSQVTGQIFVPTSLHYPYNLSKKQLKLLTKG 340
            | ..::.:.::::.|....||.:...|:|:...|
Human   318 NKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 38/155 (25%)
LPLNP_000228.1 Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:30559189 32..53 5/27 (19%)
Lipase 33..473 CDD:332983 74/342 (22%)
Essential for determining substrate specificity. /evidence=ECO:0000269|PubMed:7592706 243..266 7/27 (26%)
Important for interaction with lipoprotein particles. /evidence=ECO:0000269|PubMed:27929370 417..421
Important for heparin binding. /evidence=ECO:0000269|PubMed:11342582 430..434
Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:26725083, ECO:0000269|PubMed:30559189 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.