DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG10116

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:290 Identity:54/290 - (18%)
Similarity:104/290 - (35%) Gaps:59/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FYKNNTKTMETSAYDDA--YDLSGSGCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYYRGGCVI 127
            |:.|..:..|.:...:|  ..|..|.....|...:.:..|:.:.|.....:::......:...:|
  Fly    24 FFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNII 88

  Fly   128 CIDYSVVASSSYMRLYTNFDT-LTGAISSIILTLFRQGFDP--KRGYMFGFSFGGQLASAV---- 185
            .:|.|          ..|.:| :..:::|:::.|..| ||.  .|..:.||:.|..||..|    
  Fly    89 SVDLS----------EANDETEIIDSVASLVIVLHNQ-FDMPLDRILVVGFAEGAHLAGGVAAKV 142

  Fly   186 ----GRSLRPHHIIESIDTCDMAGPGFDPIAVDH--SKA-GKHVQCFHSSR-DKGTFVYSCHRNI 242
                ||.|..   |.::|....|       .:||  |:| .:.|:..|::. .:||:....|.:.
  Fly   143 QQDLGRQLSQ---ITALDPSSGA-------ELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDY 197

  Fly   243 MLGSCGLKQPSVASQLHLGSHGLCVDIYINTFDYPFYAVNYTPPECFTWQKTAKIP--------- 298
            .... |..||           |...|...:...:...|..::|...|...:...:.         
  Fly   198 YPNG-GQTQP-----------GCTTDSCSHERAFELLAEMWSPENDFVSARCGSVETLSASSCRW 250

  Fly   299 DGYTVGYEENFDSQVTGQIFVPTSLHYPYN 328
            ..:.:|.::..:...:|..|:.|....|::
  Fly   251 STHKMGQKQEEEQPASGIYFLETRQSSPFS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 32/155 (21%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 52/282 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.