DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and lipca

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:388 Identity:81/388 - (20%)
Similarity:144/388 - (37%) Gaps:96/388 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILIVCCVLLI----DGTHSKLNLKYAILRQKQAAKATQNDTLAH-QQRIKYDAQKTMKVMFYKNN 69
            |.||.|.|:|    ||.               ..:..:.||... :.:::|:.:...:|  |.:.
Zfish     5 IKIVLCFLMISQLTDGA---------------TFQGNRADTEPEARMKMRYEPKSVFRV--YTDG 52

  Fly    70 TKTMETSAYD--DAYDLSGSGCSPTDKFAIVLHGW-IQSCSDEWALSLIERLSYYRGGC-VICID 130
            ..|.:|.|.:  ..:.|...|.:.:...||::||| :....::|...|...|....|.. |:..|
Zfish    53 EYTEDTCALELFQPHTLDACGFNSSLPLAIIIHGWSVDGMMEKWISRLASALKSSEGNINVLIAD 117

  Fly   131 YSVVASSSYMRLYTNFDTLTGAISSIILTL--FRQGFDPKRGYMFGFSFGGQLASAVGRSL-RPH 192
            :..:|...|.....|...:...|:.::..|  |:| |...:.::.|:|.|..::...|.:| ...
Zfish   118 WLTLAHQHYPIAAQNTRIVGQDIAHLLSWLEDFKQ-FPLGKVHLIGYSLGAHISGFAGSNLAMSG 181

  Fly   193 HIIESIDTCDMAGPGFDPIAVDHSKAGKHVQCFHSSR---DKGTFVYSCHRNIM--LG-SCGLKQ 251
            ..:..|...|.|||.|:.::             |:.|   :...||.:.|...:  :| |.|:||
Zfish   182 RTLGRITGLDPAGPMFEGMS-------------HTDRLSPEDAKFVDAIHTFTLQRMGLSVGIKQ 233

  Fly   252 P-------------SVASQL-------HLGSHGL-------------CVDIYINTF---DYPFYA 280
            |             ....||       ||..||:             .|.::|::.   |....|
Zfish   234 PVAHFDFYPNGGSFQPGCQLHMQNIYAHLAQHGIMGFEQTVKCAHERAVHLFIDSLLNKDKQIMA 298

  Fly   281 VN------YTPPECFTWQKTAKIPDGYTVGYE-ENFDSQVTGQIFVPTSLHYPYNLSKKQLKL 336
            ..      :....|...:|..    ..|:||: :...:..:.::|:.|..|.||.|...|.::
Zfish   299 YKCSDNTAFDKGNCLDCRKNR----CNTLGYDIKKVRTGKSKRLFLKTRSHMPYKLFHYQFRI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 35/150 (23%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 70/334 (21%)
Pancreat_lipase_like 54..344 CDD:238363 63/307 (21%)
PLAT_LPL 351..485 CDD:238856 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.