DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and lipg

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_956422.1 Gene:lipg / 393096 ZFINID:ZDB-GENE-040426-699 Length:500 Species:Danio rerio


Alignment Length:401 Identity:77/401 - (19%)
Similarity:134/401 - (33%) Gaps:121/401 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SILIVCCVLLIDGTHS------------KLNLKYAILRQKQAAKATQNDTLAHQQRIKYDAQKTM 61
            |:.|..|.|.:...||            .||        :.|......|:.....:|.|:.:|::
Zfish     5 SLKIALCFLCVILCHSFSAFAAAPDESAPLN--------EDAENFFPTDSAVLHDKISYNMRKSL 61

  Fly    62 KVMFYKNNTKTMETSAYDDAYDLSGSGC--SPTDKFAIV-------------LHGWIQS-CSDEW 110
                                 ||....|  .|..|.:||             :|||..| ..:.|
Zfish    62 ---------------------DLGDGACYLQPGKKESIVACGFNATLRTILIIHGWTMSGMFESW 105

  Fly   111 ALSLIERLSYYRGGC-VICIDYSVVASSSYMRLYTNFDTLTGAISSIILTLF-----RQGFDPKR 169
            ...|:..:....... |:.:|:..:|:    :||.:....|..:...|.||.     .:....:.
Zfish   106 MHKLVAAVQRRESEANVVVVDWLGLAN----QLYPDAVNHTRRVGQSIATLLDWLQEEEQLQLEN 166

  Fly   170 GYMFGFSFGGQLASAVGRSLRPHHIIESIDTCDMAGPGFDPIAVDHSKAGKHVQCFHSSRDKGTF 234
            .::.|:|.|..:|...|..:  :.||..|...|.|||.|:. |..::|.         |.|...|
Zfish   167 VHIIGYSLGAHVAGYAGTFV--NGIIGRITGLDPAGPMFEG-ADSYNKL---------SPDDADF 219

  Fly   235 VYSCH---RNIMLGSCGLKQP-----------------------SVASQLHLGS----HGLCVDI 269
            |...|   |..:..|.|:::|                       |.||...:.:    |...|.:
Zfish   220 VDVLHTYTRGALGVSIGIQEPIGHIDIYPNGGDVQPGCTFGEFLSAASGNFMEAMKCEHERAVHL 284

  Fly   270 YINTF---DYPFYAVNYTPPE------CFTWQKTAKIPDGYTVGYEENFDSQVTGQIFVPTSLHY 325
            ::::.   |:..||...|.|:      |.:.:|......||..   :....:...::::.|....
Zfish   285 FVDSLMNKDHVSYAFQCTGPDRFKKGICLSCRKNRCNSIGYNA---KKMRKRRNSKMYLKTRADT 346

  Fly   326 PYNLSKKQLKL 336
            |:.....|:|:
Zfish   347 PFGGYHYQMKM 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 34/165 (21%)
lipgNP_956422.1 lipo_lipase 55..488 CDD:132274 66/343 (19%)
Pancreat_lipase_like 65..344 CDD:238363 59/297 (20%)
PLAT_LPL 351..486 CDD:238856 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.