DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG10163

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster


Alignment Length:92 Identity:27/92 - (29%)
Similarity:36/92 - (39%) Gaps:20/92 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HSKLN--LKYAILRQ-KQAAKATQNDTLA-HQQRIKYDAQKTMKVMFYKNNTKTM-ETSAYDDAY 82
            |..:|  ..|.:||. |.|..|.|:.||| |.......|....  :|.|.|.:.: :..|.|.| 
  Fly   166 HLSVNGYFVYKLLRALKDAGIAVQDITLAGHSVGANIAALGAQ--LFAKENKQLVGQLLAIDPA- 227

  Fly    83 DLSGSGCSPTDKF--------AIVLHG 101
                :.|..||..        .:||||
  Fly   228 ----TMCRTTDILVKQSVALRVVVLHG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 13/47 (28%)
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 27/92 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.