DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG13282

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:300 Identity:60/300 - (20%)
Similarity:105/300 - (35%) Gaps:80/300 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KTMETSAYDDAYDLSGSGCSPTDKFAIVLHGW--------IQSCSDEWALSLIERLSYYRGGCVI 127
            :::|.|...|:|      .:|.....|::||:        :|...:|:    :.:..|.    :|
  Fly    97 ESLEKSNLTDSY------FNPRYPTKIIIHGYNSDMFLHPLQQMREEY----LAKADYN----II 147

  Fly   128 CIDYSVVA-SSSYMRLYTNFDTLTGAISSIILTLFRQGFDPKRGYMFGFSFGGQLASAVGRSLRP 191
            .:|:|::: ...|:....|........:.::..|...|....  ::.|||.|.|:.:.:.|:| .
  Fly   148 YVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVETGNTDI--HVIGFSLGAQVPNYIARNL-S 209

  Fly   192 HHIIESIDTCDMAGPGF---------DP-----IAVDHSKA---GKHVQCFHSSRDKGTFVYSCH 239
            ..::..|...|.|.|.|         ||     :.|.|:.|   ||..:|.|:.       :..:
  Fly   210 SFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKMERCGHAD-------FYMN 267

  Fly   240 RNIMLGSC-GLKQPSVASQLHLGSHGLCVDIYINTF------------DYPFYAVNYTPPECFTW 291
            ..||...| |.|..|.|.     ||......::.:.            .|..|.:...||..|..
  Fly   268 GGIMQPGCNGQKINSFAC-----SHQRAPAYFLESIRSPKGFWGWACSGYISYLLGMCPPTNFLL 327

  Fly   292 QKTAKIPDGYTVGYEENFDSQVTGQIFVPTSLHYPYNLSK 331
            :.            .||......|...:.|:...|:.|.|
  Fly   328 EA------------GENIRPTTRGMFMIDTNDSSPFALGK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 29/145 (20%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 57/294 (19%)
Pancreat_lipase_like 75..347 CDD:238363 57/290 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.