DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG7367

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster


Alignment Length:323 Identity:68/323 - (21%)
Similarity:109/323 - (33%) Gaps:96/323 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QRIKY-----DAQKTMKVMFYKNNTKTMETSAYDDAYDLSGSGCSPTDKF------AIVLHGWIQ 104
            |.||:     |:..:......:||.:..:....|...:::       :||      .|::|||..
  Fly    93 QLIKFELYGSDSSSSADFWIDENNFEFPQRHKRDTWQEMA-------EKFNPELDTKILVHGWKS 150

  Fly   105 SCSDEWALSLIERLSYYRGG--CVICIDYSVVASSSYMRLYTNFDTLTG-AISSII-LTLFRQGF 165
            |.......|:  |.:|...|  .|..|::...|.:.|......:....| |::.:| |.:..:..
  Fly   151 STMSNSIQSI--RGAYIERGQVNVFAINWKDQADNIYYLTPARYTVQVGRAVAKLIDLLVEEKDA 213

  Fly   166 DPKRGYMFGFSFGGQLASAVGRSLRPHHIIESIDTCDMAGPGFDPIAVDHSKAGKHVQCF----H 226
            ||.|.::.|.|.|..:....|...:  :.:..|...|.|.|.|:             .|.    |
  Fly   214 DPNRIHLIGHSLGAHIMGYAGSYTK--YRVNRITGLDPARPAFE-------------DCIGPENH 263

  Fly   227 SSRDKGTFV---YSCHRNIMLGSCGLKQP------------------SVASQLHLG-SHGLCVDI 269
            .......||   :||     .|..|.::|                  ...||:..| |||...:.
  Fly   264 LDDTDANFVDVIHSC-----AGYLGFRKPIGMVDFYPNGGGPPQPGCKELSQIFTGCSHGRSYEY 323

  Fly   270 YINTFDYP--FYAV-----------NYT----------PPEC--FTWQKTAKIPDGYTVGYEE 307
            |..:.:.|  ||.|           |.|          |.|.  ..:.|||..| .|.:|.::
  Fly   324 YAESINSPKGFYGVPCSGLDELKGKNCTGGKILMGDPVPREARGIFFVKTANKP-SYALGIDD 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 33/153 (22%)
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 59/287 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.