DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG14034

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:253 Identity:59/253 - (23%)
Similarity:93/253 - (36%) Gaps:72/253 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 VICIDYSVVASSSYMRLYT----NFDTLTGAISSIILTLFRQGFDPKRG-YMFGFSFGGQLASAV 185
            :|.:||..:|   |...||    |...:....:.::..|...|...... ::.|...|..:|..:
  Fly    99 LISLDYPKLA---YEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFI 160

  Fly   186 GRSLRPHHIIESIDTCDMAGPGF---DP-IAVDHSKAGKHVQCFHSSRDKGTFVYSCHRNI-MLG 245
            |:.| |.|.:|.|...|.|.|.:   || :.:|.:.|              .||...|.:: |||
  Fly   161 GQFL-PEHKLEHITALDPAKPFYMVKDPALKLDPTDA--------------KFVDVVHTDVTMLG 210

  Fly   246 ------------SCGLKQPSVA----SQLHLGSHGLCVDIYINTFD-----YPFYAVNYTPPECF 289
                        :.|:.||:..    .:.|...|....|.|..:..     |.||..|:.     
  Fly   211 LLDAVGHVDFYLNMGVSQPNCGPINKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFK----- 270

  Fly   290 TWQKTAKIPD------GYTVGYEENFDSQVTGQIFVPTSLHYPY----NLS--KKQLK 335
            ::.|...|||      |:.|      |.:..|:.|:.|:...||    |.:  .:|||
  Fly   271 SFAKGICIPDKNIELMGFHV------DPKARGRYFLDTNNGPPYAKGENFTSISRQLK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 22/86 (26%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 52/232 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.