DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG18641

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster


Alignment Length:309 Identity:66/309 - (21%)
Similarity:110/309 - (35%) Gaps:70/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KVMFYKNNTKTMETSAYDDAYD---LSGSGCSPTDKFAIVLHGW-----IQSCSDEWALSLIERL 118
            |:.||....:|.|...:.|..|   |..:..:|.....|::||:     :....|       .|.
  Fly    69 KIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPD-------LRE 126

  Fly   119 SYYRGG--CVICIDYSVVASS---SYMRLYTNFDTLTGAISSIILTLFR--QGFDPKRGYMFGFS 176
            :|:..|  .:|.:||:.....   |.|.....|.:|  .||.::..|.|  :|..|...:..|:|
  Fly   127 AYFSVGEYNIIIVDYADAVKEPCLSQMDWAPRFGSL--CISQLVKYLARHPRGVQPDDLHFIGYS 189

  Fly   177 FGGQLASAVGRSLRPHH----IIESID-----------TCDMAGPGFDPIAVDHSKAGKHVQCFH 226
            .|..:|..|...|:|..    .|.::|           :.|:.......:.|.|:.||...| :|
  Fly   190 VGAHIAGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQ-WH 253

  Fly   227 SSRDKGTFVYSCHRNIMLGSCGLKQPSVASQLHLGSHGLCVDIYINTFDYPFYAVNYTPPECFTW 291
            ||.....:|          :.|.:||:......|.....|....:.    |::..:.|....|  
  Fly   254 SSGHADFYV----------NGGTRQPACVGSATLFQTLACDHTKVT----PYFIESITTTRGF-- 302

  Fly   292 QKTAKIPD--GYTVGYEENFDSQ-----------VTGQIFVPTSLHYPY 327
             .....|:  .|.:|:.|..||:           ..|..:|.|:...|:
  Fly   303 -YAGPCPNLFSYLIGWCEPKDSEYVLMGEHCSHKARGNYYVTTNAKAPF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 38/173 (22%)
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 65/303 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.