DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG6847

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster


Alignment Length:296 Identity:67/296 - (22%)
Similarity:109/296 - (36%) Gaps:84/296 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IVLHGWIQSCSDEWALSLIERLSYYRGGCVICIDYSVVAS-SSYMRLYTNFDTLTGAISSIILTL 160
            :::||:..:|...|...:...|.......|||:|:...|: .:|:|...| ..|.|...:::|..
  Fly   194 VIVHGFGSACPHVWIYEMKTALMAVEDCIVICVDWENGATFPNYVRAAAN-TRLVGKQLAMLLRN 257

  Fly   161 FRQ--GFDPKRGYMFGFSFGGQLASAVGRSLRPHHIIESIDTCDMAGPGFD----PIAVDHSKAG 219
            .:|  |.|..|.::.|||.|..::...|..|..   :..|...|.|||.|:    .:.:|.|.| 
  Fly   258 LQQHKGLDLMRTHVIGFSLGAHVSGFAGAELPG---LSRITGLDPAGPLFEAQHPKVRLDSSDA- 318

  Fly   220 KHVQCFHSSRDKGTFVYSCHRNIMLGSCGLKQP--------------SVASQLHLGS-------- 262
            :.|...||:.:          |::||..|..||              :..|.|.:|:        
  Fly   319 EFVDVIHSNGE----------NLILGGLGSWQPMGHVDYYPNGGRVQTGCSNLFVGAVTDFIWSA 373

  Fly   263 --------HGLCVDIYINTFDYPFYAVNYTPPECFTWQKTAKIPDGYTVGYEENFDSQVTGQIF- 318
                    ..||    .:...|.|: ::...|.|.    ....|.|       |:|..:.|:.| 
  Fly   374 QAAEDEEGRSLC----NHRRAYKFF-IDSVAPRCL----FPAFPCG-------NYDDFLKGRCFP 422

  Fly   319 -----------VPTSLHYPY----NLSKKQLKLLTK 339
                       ||...:..|    :..:.||.|||:
  Fly   423 CAQDDEDLAEGVPRCGNMGYYADRSTGRGQLYLLTR 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 31/113 (27%)
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 67/296 (23%)
Pancreat_lipase_like 185..459 CDD:238363 67/296 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.