DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG5162

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster


Alignment Length:277 Identity:53/277 - (19%)
Similarity:89/277 - (32%) Gaps:78/277 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KFAIVLHGWIQSCSDEWALSLIERLSYYRGGCVICIDYSVVASSSYM-RLYT--NFDT------- 148
            |..|:..||..:.:....:.:..:....||.    :::..|.::.:: .|||  .|:|       
  Fly   132 KVVILATGWTTTVNGSDTIEVFSKAYNCRGD----VNFVAVDAARFVDTLYTWSAFNTEEIGENI 192

  Fly   149 LTGAISSIILTLFRQGFDPKRG-YMFGFSFGGQLASAVGRSLR--PHHIIESIDTCDMAGPGFDP 210
            ..|.:..:.|.       |... ::.|.|.|..:..:.||.|:  .:..|..|...|.|.|    
  Fly   193 ALGLVKLLDLV-------PVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKP---- 246

  Fly   211 IAVDHSKAGKHVQCFHSS-------RDKGTFVYSCHRNIMLGSCGLKQ--------PSVASQLHL 260
                         ||:..       |....||...|.|  .|..|.:.        |...|.|..
  Fly   247 -------------CFNEGEALSGLMRGDAHFVDVIHSN--PGVLGKRDPVGDVDFYPGGMSPLAA 296

  Fly   261 G------SHGLCVDIYINTFDYPFYAVNYTPPECFTWQKTA-------KIPDGYTVGYEENFDSQ 312
            |      :|....:.:..|. :|....|:....|.:..|..       ::|.||.|      ...
  Fly   297 GCFSVTCAHARSWEYFAETV-FPGNERNFMATRCNSISKLRDFRCPGDEVPMGYAV------PQN 354

  Fly   313 VTGQIFVPTSLHYPYNL 329
            :.|..|:..|...|:.:
  Fly   355 IKGNYFLEVSASAPFGM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 26/126 (21%)
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 52/273 (19%)
Pancreat_lipase_like 99..365 CDD:238363 51/269 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.