DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and CG1986

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster


Alignment Length:394 Identity:80/394 - (20%)
Similarity:135/394 - (34%) Gaps:102/394 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HSILIVCCVLL------IDGTH--SKLNLKYAILRQKQAAKATQNDTLAHQQRIKYDAQKTMKVM 64
            |.:|:.|.:.|      |:..|  |.:...:..|::.....:.:...|.|  .|.::. :|:...
  Fly     7 HLLLLGCLLCLLGDVPRIEAFHRWSPMMKAFRYLQETMLRNSLERAHLNH--GIVFEC-RTISAK 68

  Fly    65 FYKNNTKTMETSAYDDAYDLSG-SGCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYYRGGCVIC 128
            .:.|     |........||.| ....|..|.|:.||||....|.:|...|:...:.:.....:|
  Fly    69 DFGN-----EVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTLFDSNYNVC 128

  Fly   129 -IDYSVVASSSYMRLYTNFDTLTGAISSIILTLFR---QGFDPKRGYMFGFSFGGQLASAVGRSL 189
             :|:..::.:.|.....:...:...::.||:.|..   ..|......:.|:|.|...|...|..|
  Fly   129 VVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAVL 193

  Fly   190 RPHHIIESIDTCDMAGPGF------------DP-----IAVDHSKAGK---HVQCFHSS------ 228
            ...  :|.|...|.|||.|            ||     :.|.|:..|.   .::|.|:.      
  Fly   194 EGQ--VEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNGG 256

  Fly   229 -------------RD-KGTFVYSCHRNIMLGSCGLKQPSVASQLHLGSHGLCVDIYINTFD--YP 277
                         || :.|...||                       ||......:..:.|  ||
  Fly   257 RAPQTNCKMFANLRDMQNTNPVSC-----------------------SHSAAAIFFRQSMDPEYP 298

  Fly   278 FYAVNYTPPECFTWQKTAKIPDGYTVGYEE-----NFDSQVTGQIFVPTSLHYPYNLSKKQLKLL 337
            |  |.|   ||.::::.|.   ||..|..:     :...:..|..:..|:...|| :.::|...|
  Fly   299 F--VGY---ECGSYREFAA---GYCDGNRKARFGIHSQRRAQGSFYFRTAPQQPY-VPRRQTNWL 354

  Fly   338 TKGG 341
            :..|
  Fly   355 SGVG 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 34/148 (23%)
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 63/311 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.