DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and Pnlip

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:333 Identity:61/333 - (18%)
Similarity:118/333 - (35%) Gaps:77/333 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 AQKTMKVMFYKNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYY 121
            ||...:.:.|.|..:........||..:..|......|..|::||:|....:.|...:.:.:...
  Rat    49 AQINTRFLLYTNENQDNYQKITSDASSIRNSNFKTNRKTRIIIHGFIDKGEENWLSDMCKNMFKV 113

  Fly   122 RGGCVICIDYSVVASSSYMRLYTNFDTLTGAISSIILTLFRQ--GFDPKRGYMFGFSFGGQLASA 184
            .....||:|:...:.::|.:...|. .:.||..::::.:.:.  |:.|...::.|.|.|..:|..
  Rat   114 ESVNCICVDWKGGSRATYTQATQNV-RVVGAEVALLVNVLKSDLGYSPDNVHLIGHSLGSHVAGE 177

  Fly   185 VGRSLRPHHIIESIDTCDMAGPGF----DPIAVDHSKAGKHVQCFHS-------------SRDKG 232
            .|:  |....|..|...|.|.|.|    :.:.:|.:.| :.|...|:             |:..|
  Rat   178 AGK--RTFGAIGRITGLDAAEPYFQGTPEEVRLDPTDA-QFVDAIHTDAAPIIPNLGFGMSQTVG 239

  Fly   233 TFVYSCHRNIMLGSCGLKQPSVASQL-----------------HLGSHGLCVDIYINTFDYPFYA 280
            ...:..:..:.:..|   |.::.||:                 ||.|:....|..:|...:..::
  Rat   240 HLDFFPNGGMEMPGC---QKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPTGFSGFS 301

  Fly   281 VN----YTPPECFTW----------------QKTAKIPDGY--TVGYEENF------------DS 311
            .:    ::..:||..                .||.::...:  ..|.:.||            ..
  Rat   302 CSSYNVFSANKCFPCGSEGCPQMGHYADKYPGKTKELYQKFYLNTGDKSNFARWRYQVTVTLSGQ 366

  Fly   312 QVTGQIFV 319
            :|||.|.|
  Rat   367 KVTGHILV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 31/145 (21%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 54/309 (17%)
PLAT_PL 355..465 CDD:238857 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.