DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and Lipg

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_034850.3 Gene:Lipg / 16891 MGIID:1341803 Length:500 Species:Mus musculus


Alignment Length:296 Identity:55/296 - (18%)
Similarity:108/296 - (36%) Gaps:51/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DAYDLSGSGCSPTDKFAIVLHGWIQS-CSDEWALSLIERLSY-YRGGCVICIDYSVVASSSYMRL 142
            |:..|...|.:.|.|...::|||..| ..:.|...|:..|.. .:...|:.:|:..:|.    :|
Mouse    70 DSKLLENCGFNMTAKTFFIIHGWTMSGMFESWLHKLVSALQMREKDANVVVVDWLPLAH----QL 130

  Fly   143 YTNFDTLTGAISSIILTLF-----RQGFDPKRGYMFGFSFGGQLASAVGRSLRPHHIIESIDTCD 202
            ||:....|..:...:..:.     ::.|.....::.|:|.|..:|...|..::  ..:..|...|
Mouse   131 YTDAVNNTRVVGQRVAGMLDWLQEKEEFSLGNVHLIGYSLGAHVAGYAGNFVK--GTVGRITGLD 193

  Fly   203 MAGPGFDPIAVDHSKA---GKHVQCFHSSR--------------------DKGTFVYSCHRNIML 244
            .|||.|:.:.::...:   ...|...|:..                    :.|.|...|..|.::
Mouse   194 PAGPMFEGVDINRRLSPDDADFVDVLHTYTLSFGLSIGIRMPVGHIDIYPNGGDFQPGCGFNDVI 258

  Fly   245 GSCGLKQPSVASQLHLGSHGLCVDIYINTF---DYPFYAVNYTPPE------CFTWQKTAKIPDG 300
            ||...   ...|::....|...|.:::::.   |.|.:|...|...      |.:.:|......|
Mouse   259 GSFAY---GTISEMVKCEHERAVHLFVDSLVNQDKPSFAFQCTDSSRFKRGICLSCRKNRCNNIG 320

  Fly   301 YTVGYEENFDSQVTGQIFVPTSLHYPYNLSKKQLKL 336
            |..   :....:...::::.|....|:.:...|||:
Mouse   321 YNA---KKMRKKRNSKMYLKTRAGMPFKVYHYQLKV 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 30/134 (22%)
LipgNP_034850.3 Pancreat_lipase_like 49..340 CDD:238363 51/281 (18%)
lipo_lipase 51..485 CDD:132274 55/296 (19%)
Heparin-binding. /evidence=ECO:0000250 325..337 0/11 (0%)
PLAT_LPL 347..483 CDD:238856 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.