DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and Lipc

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_006510879.1 Gene:Lipc / 15450 MGIID:96216 Length:526 Species:Mus musculus


Alignment Length:313 Identity:57/313 - (18%)
Similarity:112/313 - (35%) Gaps:70/313 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LSGSGCSPTDKFAIVLHGW-----------------IQSCSDEWALSLIERLSYYRGGCVI--CI 129
            |...|.:.:....:::|||                 :....:.|...::..|...:...|.  .:
Mouse    73 LQECGFNSSQPLIMIIHGWSGSESATVGKDSDSDYQVDGLLENWIWKIVSALKSRQSQPVNVGLV 137

  Fly   130 DYSVVASSSYMRLYTNFDTLTGAISSIILTLFRQG-FDPKRGYMFGFSFGGQLASAVGRSLRPHH 193
            |:..:|...|.....|...:...:::::|.|.... |...:.::.|:|.|..::...|.|:...:
Mouse   138 DWISLAYQHYTIAVQNTRIVGQDVAALLLWLEESAKFSRSKVHLIGYSLGAHVSGFAGSSMDGKN 202

  Fly   194 IIESIDTCDMAGPGFDPIAVDHSKAGKHVQCFHSSRDKGTFVYSCH---RNIMLGSCGLKQPSVA 255
            .|..|...|.|||.|:..:.:.          ..|.|...||.:.|   |..|..|.|:|||...
Mouse   203 KIGRITGLDPAGPMFEGTSPNE----------RLSPDDANFVDAIHTFTREHMGLSVGIKQPIAH 257

  Fly   256 SQL------------------HLGSHGL--------C-----VDIYINTFDY-PFYAVNYTPPEC 288
            ...                  |:..|||        |     |.::|::..: ...::.:...:.
Mouse   258 YDFYPNGGSFQPGCHFLELYKHIAEHGLNAITQTIKCAHERSVHLFIDSLQHSDLQSIGFQCSDM 322

  Fly   289 FTWQK----TAKIPDGYTVGYEENFD-SQVTGQIFVPTSLHYPYNLSKKQLKL 336
            .::.:    :.|.....|:||:...| |..:.::|:.|....|:.:...|.|:
Mouse   323 GSFSQGLCLSCKKGRCNTLGYDIRKDRSGKSKRLFLITRAQSPFKVYHYQFKI 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 26/143 (18%)
LipcXP_006510879.1 Lipase 18..366 CDD:333880 54/302 (18%)
PLAT_LPL 369..504 CDD:238856 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.