DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:321 Identity:66/321 - (20%)
Similarity:104/321 - (32%) Gaps:104/321 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NTKTMETSAYDDAYDLSGSGCSPTDKFA-IVLHGWIQSCSDEWALSLIERLSYYRGGCVICIDYS 132
            |:.|::.|.:.            |||.. |.:.||  ....:|...:...|........|.:|: 
Human    74 NSSTIQASYFG------------TDKITRINIAGW--KTDGKWQRDMCNVLLQLEDINCINLDW- 123

  Fly   133 VVASSSYMRLYTNFDTLTGAISSIILTLFRQ-GFDPKRGYMFGFSFGGQLASAVGRSLRPHHIIE 196
            :..|..|:....|...:...::..|..|.:: .:.|.:.::.|.|.|..||...|..:..   :.
Human   124 INGSREYIHAVNNLRVVGAEVAYFIDVLMKKFEYSPSKVHLIGHSLGAHLAGEAGSRIPG---LG 185

  Fly   197 SIDTCDMAGPGF----DPIAVDHSKAGKHVQCFHSSRDK-------GTFVYSCHRNIMLGSCGLK 250
            .|...|.|||.|    ..:.:|.|.| ..|...|::..:       ||          :.:||  
Human   186 RITGLDPAGPFFHNTPKEVRLDPSDA-NFVDVIHTNAARILFELGVGT----------IDACG-- 237

  Fly   251 QPSVASQLHL------GSH--GLCVDI---------------YINTFD------YPFYAVNYTPP 286
                    ||      |.|  | |.|:               ..:.||      |.|||.:...|
Human   238 --------HLDFYPNGGKHMPG-CEDLITPLLKFNFNAYKKEMASFFDCNHARSYQFYAESILNP 293

  Fly   287 ECFTWQKTAKIPDGYTVGYE-ENFDSQVTGQIF------VPTSLHYPYNLSKKQLKLLTKG 340
            :.|             :.|. .::.|...|..|      .||..|:......|.:|  |.|
Human   294 DAF-------------IAYPCRSYTSFKAGNCFFCSKEGCPTMGHFADRFHFKNMK--TNG 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 30/140 (21%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 66/321 (21%)
Pancreat_lipase_like 52..348 CDD:238363 66/321 (21%)
PLAT_PL 355..467 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.