DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:302 Identity:61/302 - (20%)
Similarity:102/302 - (33%) Gaps:88/302 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NDTLAHQQRIKYDAQKTMKVMFYKNNTKTMETSAYDDAYDLSGSGCSPTDKFAIVLHGWIQSCSD 108
            |:...:.|:|......|:|...::.:.||                       ..::||:|....|
  Rat    74 NENPNNYQKISATEPDTIKFSNFQLDRKT-----------------------RFIVHGFIDKGED 115

  Fly   109 EWALSLIERLSYYRGGCVICIDYSVVASSSYMRLYTNFDTLTGAISSIILTLFRQ-GFDPKRGYM 172
            .|.|.:.:::........||:|:...:.:.|.:...|...:...|:.::..|..: |:.|:..::
  Rat   116 GWLLDMCKKMFQVEKVNCICVDWRRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHL 180

  Fly   173 FGFSFGGQLASAVGRSLRPHHIIESIDTCDMAGPGF---------DP-----IAVDHS------- 216
            .|.|.|..:....||.|..|  :..|...|.|.|.|         ||     :.|.|:       
  Rat   181 IGHSLGAHVVGEAGRRLEGH--VGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIP 243

  Fly   217 --------KAGKHVQCFHSSRDKGTFVYSCHRNIMLGSCGLK------QPSVASQLHLGSHGLCV 267
                    |.| |:..|.:.   |..:..|.:||:.....:.      |..||.. ||.|     
  Rat   244 YLGFGMSQKVG-HLDFFPNG---GKEMPGCQKNILSTIVDINGIWEGTQNFVACN-HLRS----- 298

  Fly   268 DIYINTFDYPFYAVNYTPPECFTWQKTAKIPDGYTVGYEENF 309
                    |.:||.:...|:.|.         ||.....|.|
  Rat   299 --------YKYYASSILNPDGFL---------GYPCSSYEKF 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 28/144 (19%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 61/302 (20%)
Pancreat_lipase_like 65..363 CDD:238363 61/302 (20%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.