DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and LOC101884800

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_005174466.1 Gene:LOC101884800 / 101884800 -ID:- Length:530 Species:Danio rerio


Alignment Length:317 Identity:59/317 - (18%)
Similarity:119/317 - (37%) Gaps:57/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KNNTKTMETSAYDDAYDLSGSGCSPTD-------KFAIVLHGW-IQSCSDEWALSLIERLSYYR- 122
            |.:.:::|....|..|.:.|...|.:|       :..:::||| :....:.|...|:..| |.| 
Zfish    42 KFSIRSVEFPDEDLCYLVPGQQDSISDCNFKNDSQTFLIIHGWSVAGLFESWVYKLVTAL-YDRE 105

  Fly   123 -GGCVICIDYSVVASSSYMRLYTNFDTLTGAISSIILTLFRQGFDPKRGYMFGFSFGGQLASAVG 186
             ...||.:|:...|:..|.:...|...:...::..:..|....:..::.::.|:|.|..:|...|
Zfish   106 PSANVIVVDWLDRANKHYPKSAENTRLVGADVAKFVNWLEELDYPLEKVHLLGYSLGAHVAGVAG 170

  Fly   187 RSLRPHHIIESIDTCDMAGPGFD---------------------------PIAVDHSKAGKHVQC 224
            .  ..::.:..|...|.|||.|:                           .:::...:...||..
Zfish   171 N--LTNNKVHRITGLDPAGPSFENADILRRLSPDDASFVDVLHTNTRGSPDLSIGIQRPVGHVDI 233

  Fly   225 FHSSRDKGTFVYSC---HRNIMLGSCGL-KQPSVASQLHLGSHGLCVDIYINTFDYPFYAV---- 281
            :.:.   |||...|   |...::.:||: ....:....|..|..|.:|..:|. .|..:|.    
Zfish   234 YPNG---GTFQPGCSIQHTMKLIATCGIYNMDQIVKCSHERSIHLFIDSLVNQ-AYQSWAFRCAS 294

  Fly   282 --NYTPPECFTWQKTAKIPDGYTVGYEENFDSQVTGQIFVPTSLHYPYNLSKKQLKL 336
              ::....|.:.:|......||.|   :...|..:.::::.|....|:.:...|:|:
Zfish   295 RDSFNKGLCLSCRKNRCNTLGYNV---KKIRSTRSTKMYLKTREMMPFKVFHYQIKM 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 32/150 (21%)
LOC101884800XP_005174466.1 lipo_lipase 35..473 CDD:132274 59/317 (19%)
Pancreat_lipase_like 39..335 CDD:238363 56/302 (19%)
PLAT 342..464 CDD:294016 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.