DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13562 and ccdc172

DIOPT Version :9

Sequence 1:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_031761725.1 Gene:ccdc172 / 100488746 XenbaseID:XB-GENE-6460356 Length:252 Species:Xenopus tropicalis


Alignment Length:94 Identity:22/94 - (23%)
Similarity:38/94 - (40%) Gaps:10/94 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NLKYAILRQK--QAAKATQNDTLAHQQRIKYDAQKTMKVMFYKNNTKTMETSAYDDAYDLSGSGC 89
            :||:.....|  |..|.|.:|.||..|....|.:..:        .:.:||:....|..|..|..
 Frog   153 SLKHESFHVKALQVQKKTLSDNLAQLQNTLKDVEDKL--------CEAVETTERLKAEKLLASQK 209

  Fly    90 SPTDKFAIVLHGWIQSCSDEWALSLIERL 118
            ..:|...:.|...::|.|.:.:.::.|.|
 Frog   210 PQSDAECLRLKKELESYSSDDSEAVYEAL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 11/55 (20%)
ccdc172XP_031761725.1 SMC_prok_B <14..>212 CDD:274008 16/66 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.