DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lpt and BAZ1B

DIOPT Version :9

Sequence 1:NP_611847.2 Gene:Lpt / 37795 FlyBaseID:FBgn0263667 Length:1482 Species:Drosophila melanogaster
Sequence 2:NP_001357331.1 Gene:BAZ1B / 9031 HGNCID:961 Length:1483 Species:Homo sapiens


Alignment Length:421 Identity:85/421 - (20%)
Similarity:148/421 - (35%) Gaps:149/421 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 RTPGGGSSSRWHSHYTICDSCYQQRNKGFSCPICQKAYRAASHKEMVKCSWCNKFVHSTCDEEAD 371
            |||.|  :.|.|:.|.:    :.....|.                .::..|    ||.:.|...:
Human   900 RTPIG--TDRNHNRYWL----FSDEVPGL----------------FIEKGW----VHDSIDYRFN 938

  Fly   372 LTAYH-KKKEQNPDYDYVCPNCKSNSSGPGSSQQTIDSIVLSAMDSSSEQLSLKEIELD---PLE 432
               :| |....:.|.|| ||..|..:.|..:|..|             :..:..|:.::   |.:
Human   939 ---HHCKDHTVSGDEDY-CPRSKKANLGKNASMNT-------------QHGTATEVAVETTTPKQ 986

  Fly   433 GKPT--MDPSSDELHKLPTGKKKVCLTSVRGRSGKFVLHRMGVM-SQINKKRSTR---------- 484
            |:..  :..|..||.:|..     |            ||..|:. ||:.::...|          
Human   987 GQNLWFLCDSQKELDELLN-----C------------LHPQGIRESQLKERLEKRYQDIIHSIHL 1034

  Fly   485 GKGRQLALPTISSDRCLSRSMETDL-----------------TSD--------KKL--------- 515
            .:...|.|.:...::.|...:.:||                 ||:        :||         
Human  1035 ARKPNLGLKSCDGNQELLNFLRSDLIEVATRLQKGGLGYVEETSEFEARVISLEKLKDFGECVIA 1099

  Fly   516 LLCSARDKF-------------IQAQDICVMCGSLGIESDSVMITCAQCGQCYHPYCAGVKPSR- 566
            |..|...||             :|::|   ...:..::.:..|:..|:.......:...::.:: 
Human  1100 LQASVIKKFLQGFMAPKQKRRKLQSED---SAKTEEVDEEKKMVEEAKVASALEKWKTAIREAQT 1161

  Fly   567 --------GILQKGWRCLDCTV------CEGCGKKNDEARLLLCDECDISYHIYCVNPPLETVPT 617
                    |:|.   .|:...:      |:.|.||.::.:|:|||||:.::|::|:.|.|..||.
Human  1162 FSRMHVLLGMLD---ACIKWDMSAENARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPD 1223

  Fly   618 GNWKCSFCTLC----QKCGRNPTEKSEFGDS 644
            |.|:|..|...    ...|||.||:|...||
Human  1224 GEWQCPACQPATARRNSRGRNYTEESASEDS 1254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LptNP_611847.2 ePHD1_KMT2C_like 109..191 CDD:277135
PHD1_KMT2C_like 205..250 CDD:276984
PHD2_KMT2C_like 252..298 CDD:276985
PHD_SF 337..392 CDD:304600 11/55 (20%)
PHD4_KMT2C_like 530..578 CDD:276987 5/56 (9%)
PHD5_KMT2C_like 580..625 CDD:276988 19/50 (38%)
PHD6_KMT2C_like 657..707 CDD:276989
NHP6B 1101..>1237 CDD:227935
HMG 1173..1231 CDD:197700
BAZ1BNP_001357331.1 WAC_Acf1_DNA_bd 21..120 CDD:337781
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..212
C motif 207..213
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..333
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..432
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 446..470
DDT 604..668 CDD:214726
DUF5401 <664..>877 CDD:340095
WHIM1 727..767 CDD:339506
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 788..817
WSD 898..1025 CDD:317927 36/184 (20%)
PHD_BAZ1B 1186..1231 CDD:277098 19/44 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1237..1326 8/18 (44%)
Bromo_WSTF_like 1344..1440 CDD:99937
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1455..1483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.