DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lpt and Tbrg1

DIOPT Version :9

Sequence 1:NP_611847.2 Gene:Lpt / 37795 FlyBaseID:FBgn0263667 Length:1482 Species:Drosophila melanogaster
Sequence 2:NP_079565.2 Gene:Tbrg1 / 21376 MGIID:1100877 Length:406 Species:Mus musculus


Alignment Length:240 Identity:50/240 - (20%)
Similarity:80/240 - (33%) Gaps:63/240 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   637 EKSEFGDSNMLECPSCTSQSSCPVCKVS------YSNGEMIIQCEHCELWAHFHCDSVNAQLTID 695
            :|...|.:..|..|.....|..||..:.      ||.||:|..      ...||.:  ||...:.
Mouse   154 KKKMEGGARKLVRPIALDPSGQPVFPIGLGGLTVYSLGEIITN------RPGFHDE--NAIYPVG 210

  Fly   696 HYDNNVYKCFKC---RCSTRSTNSLADAKFGNEDSLAITPQGSKPFVHITASSGPSFDS------ 751
            :....||...||   :|  ..|..:.|.  |.:....|.|:.......:.:|:...::.      
Mouse   211 YCSTRVYASMKCPDQKC--LYTCQIKDG--GVQPQFEIVPEDDPQNTIVGSSADACYEELLRAIS 271

  Fly   752 -----------KSGAE---RNHPTLSGDMPESAPEA-----LHWID-GVCLSESGLGMIKSLSTE 796
                       ..||:   .:|||:. ::.:|.|||     ..|:. ..|....|     .||.|
Mouse   272 ATTGKLMPNPLSCGADFFGFSHPTIH-NLIQSCPEAQNCVNYQWVKFDACKPRKG-----QLSQE 330

  Fly   797 IKRKRKMRQALGNGKDGQLEAAAEEALEKYKDGMVWDGTENAIPE 841
            :..         |.....|||...:..:...|..:..|:.: :||
Mouse   331 LPE---------NDATMSLEAFQTQTFDDDHDDSILPGSLD-LPE 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LptNP_611847.2 ePHD1_KMT2C_like 109..191 CDD:277135
PHD1_KMT2C_like 205..250 CDD:276984
PHD2_KMT2C_like 252..298 CDD:276985
PHD_SF 337..392 CDD:304600
PHD4_KMT2C_like 530..578 CDD:276987
PHD5_KMT2C_like 580..625 CDD:276988
PHD6_KMT2C_like 657..707 CDD:276989 13/55 (24%)
NHP6B 1101..>1237 CDD:227935
HMG 1173..1231 CDD:197700
Tbrg1NP_079565.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..144
FYRN 184..233 CDD:283589 15/58 (26%)
FYRC 239..314 CDD:283590 12/75 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.