Sequence 1: | NP_611847.2 | Gene: | Lpt / 37795 | FlyBaseID: | FBgn0263667 | Length: | 1482 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509376.2 | Gene: | F22F1.3 / 184851 | WormBaseID: | WBGene00017715 | Length: | 245 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 40/200 - (20%) |
---|---|---|---|
Similarity: | 71/200 - (35%) | Gaps: | 44/200 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 1161 DEDLGLMA------TISAVLYANTEHPNLKELFPIWNDRCKQILKRWRSLCNEKKAPFLQKAKDN 1219
Fly 1220 RSALRQR---REQNKIPMPPKPQKQEEMGRVWKQPPKLKEDQPNMFVTYNGNAYDMGNYVGGSAQ 1281
Fly 1282 AASN--NPNPHHVM-PNVNDNLVIKATMQRTQVHTTAASTLKMTTVDNRLELNTAVYGTEPIGDK 1343
Fly 1344 KLRNL 1348 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lpt | NP_611847.2 | ePHD1_KMT2C_like | 109..191 | CDD:277135 | |
PHD1_KMT2C_like | 205..250 | CDD:276984 | |||
PHD2_KMT2C_like | 252..298 | CDD:276985 | |||
PHD_SF | 337..392 | CDD:304600 | |||
PHD4_KMT2C_like | 530..578 | CDD:276987 | |||
PHD5_KMT2C_like | 580..625 | CDD:276988 | |||
PHD6_KMT2C_like | 657..707 | CDD:276989 | |||
NHP6B | 1101..>1237 | CDD:227935 | 18/84 (21%) | ||
HMG | 1173..1231 | CDD:197700 | 14/60 (23%) | ||
F22F1.3 | NP_509376.2 | KIX | 7..87 | CDD:280354 | 18/81 (22%) |
KIX | 128..208 | CDD:280354 | 11/57 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5076 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |