DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lpt and F22F1.3

DIOPT Version :9

Sequence 1:NP_611847.2 Gene:Lpt / 37795 FlyBaseID:FBgn0263667 Length:1482 Species:Drosophila melanogaster
Sequence 2:NP_509376.2 Gene:F22F1.3 / 184851 WormBaseID:WBGene00017715 Length:245 Species:Caenorhabditis elegans


Alignment Length:200 Identity:40/200 - (20%)
Similarity:71/200 - (35%) Gaps:44/200 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1161 DEDLGLMA------TISAVLYANTEHPNLKELFPIWNDRCKQILKRWRSLCNEKKAPFLQKAKDN 1219
            |:||..:.      .|:.::......||....    ||.....||.:.:.. |||:....:.||.
 Worm    10 DDDLSTLERGLRQYMITKIVREAVPRPNSDAK----NDARMIELKEYATFM-EKKSFEKVQTKDE 69

  Fly  1220 RSALRQR---REQNKIPMPPKPQKQEEMGRVWKQPPKLKEDQPNMFVTYNGNAYDMGNYVGGSAQ 1281
            ..|...|   ..|..:...||...::....:   ||                ::::.:::|.|||
 Worm    70 YYAELARIILSMQKHLQSRPKGSYEDPYSNI---PP----------------SHELADFLGLSAQ 115

  Fly  1282 AASN--NPNPHHVM-PNVNDNLVIKATMQRTQVHTTAASTLKMTTVDNRLELNTAVYGTEPIGDK 1343
            ....  ..:||.:: ||....:.     :|.::|......|.:....::   |....|......:
 Worm   116 ERDEFYLLHPHRLLKPNAKSRIT-----RRIRIHVIDKLGLMLFPAPDQ---NAYYDGRMDRIIR 172

  Fly  1344 KLRNL 1348
            |||||
 Worm   173 KLRNL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LptNP_611847.2 ePHD1_KMT2C_like 109..191 CDD:277135
PHD1_KMT2C_like 205..250 CDD:276984
PHD2_KMT2C_like 252..298 CDD:276985
PHD_SF 337..392 CDD:304600
PHD4_KMT2C_like 530..578 CDD:276987
PHD5_KMT2C_like 580..625 CDD:276988
PHD6_KMT2C_like 657..707 CDD:276989
NHP6B 1101..>1237 CDD:227935 18/84 (21%)
HMG 1173..1231 CDD:197700 14/60 (23%)
F22F1.3NP_509376.2 KIX 7..87 CDD:280354 18/81 (22%)
KIX 128..208 CDD:280354 11/57 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.