DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lpt and C49F5.5

DIOPT Version :9

Sequence 1:NP_611847.2 Gene:Lpt / 37795 FlyBaseID:FBgn0263667 Length:1482 Species:Drosophila melanogaster
Sequence 2:NP_001359599.1 Gene:C49F5.5 / 183614 WormBaseID:WBGene00008209 Length:115 Species:Caenorhabditis elegans


Alignment Length:127 Identity:31/127 - (24%)
Similarity:45/127 - (35%) Gaps:32/127 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 KFIQAQDICVMCGSLGIESDSVMITCAQCGQ-CYHPYCAGVKPSRGILQKGWRCLD-CTVCEGCG 585
            |.|:.|.|.::..::..:.|......|..|| ..||.|.  .||.|:.:.....|: ||....| 
 Worm    16 KVIKEQLILLLHANVCTKRDRENYQAAINGQPARHPRCD--LPSCGLFKYTLSHLNMCTNGSHC- 77

  Fly   586 KKNDEARLLLCDECDISYHIYCVNPPLETVPTGNWK-CS--FCTLCQKCGRNPTEKSEFGDS 644
                     |.|.|:.|..:           ..:|: |.  .|.:|....|..|    ||.|
 Worm    78 ---------LIDYCNTSKQL-----------IKHWRECQNRACAICAPLRRLQT----FGGS 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LptNP_611847.2 ePHD1_KMT2C_like 109..191 CDD:277135
PHD1_KMT2C_like 205..250 CDD:276984
PHD2_KMT2C_like 252..298 CDD:276985
PHD_SF 337..392 CDD:304600
PHD4_KMT2C_like 530..578 CDD:276987 12/49 (24%)
PHD5_KMT2C_like 580..625 CDD:276988 7/47 (15%)
PHD6_KMT2C_like 657..707 CDD:276989
NHP6B 1101..>1237 CDD:227935
HMG 1173..1231 CDD:197700
C49F5.5NP_001359599.1 ZnF_TAZ 12..106 CDD:214717 26/112 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.