DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lpt and F13C5.2

DIOPT Version :9

Sequence 1:	NP_611847.2	Gene:	Lpt / 37795	FlyBaseID:	FBgn0263667	Length:	1482	Species:	Drosophila melanogaster
Sequence 2:	NP_508124.1	Gene:	F13C5.2 / 180410	WormBaseID:	WBGene00017423	Length:	374	Species:	Caenorhabditis elegans

Alignment Length:	132	Identity:	29/132 - (21%)
Similarity:	49/132 - (37%)	Gaps:	27/132 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly  1150 GTQKTAEKMRKDEDLGLMATISAVLYANTE--HPNLKELFPIWNDRCKQILKRW-RSLCNEKKAP 1211
            |.:|.|:...:||             |.::  |..||        :|..|||.: :|..:....|
Worm    97 GRKKKAKSESEDE-------------AESDHLHDELK--------KCLSILKEFEKSTHDSFTFP 140

  Fly  1212 FLQKAKDNRSALRQRREQNKIPMPPKPQKQEEMGRVWKQPPKLKED---QPNMFVTYNGNAYDMG 1273
            |.:........|....|..|.||.....:::.:|..:....:.|||   ..|..:|||.....:.
Worm   141 FRKPVDVVLLGLTDYHEVIKKPMDMSTIRKKLIGEEYDTAVEFKEDFKLMINNCLTYNNEGDPVA 205

  Fly  1274 NY 1275
            ::
Worm   206 DF 207

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lpt	NP_611847.2	ePHD1_KMT2C_like	109..191	CDD:277135
		PHD1_KMT2C_like	205..250	CDD:276984
		PHD2_KMT2C_like	252..298	CDD:276985
		PHD_SF	337..392	CDD:304600
		PHD4_KMT2C_like	530..578	CDD:276987
		PHD5_KMT2C_like	580..625	CDD:276988
		PHD6_KMT2C_like	657..707	CDD:276989
		NHP6B	1101..>1237	CDD:227935	21/89 (24%)
		HMG	1173..1231	CDD:197700	13/60 (22%)
F13C5.2	NP_508124.1	Bromodomain	118..219	CDD:383021	22/98 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5076
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900