DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Upf3 and upf3

DIOPT Version :9

Sequence 1:NP_611844.3 Gene:Upf3 / 37792 FlyBaseID:FBgn0034923 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_593705.1 Gene:upf3 / 2542908 PomBaseID:SPAC13G7.03 Length:278 Species:Schizosaccharomyces pombe


Alignment Length:296 Identity:83/296 - (28%)
Similarity:137/296 - (46%) Gaps:45/296 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KIVMRHLPPTMTEAQFLDQVGP-LPENDSYYYCKADWSLGQEATCRAYIDMSSKDIGEVVQFRDR 94
            |:::.:||||:.|..||..:.. ||..:.:.:.|...::|..:...::..:..:....|.:|...
pombe    13 KVLVFNLPPTLPEQVFLQSINSFLPHVEWHRFSKGKATVGTRSELLSFAYLKFQSATAVQEFFRV 77

  Fly    95 FDGYVFVDHKGVEYMAIVEYAPFQCFLKNKARNDDSKVNTIESEPHYQEFIKRLAQEREEASRMG 159
            :.|:.|:|.|...|.|||..||:|....:|.: .||...::|.:|.:|||  ::.:|....:...
pombe    78 YQGHTFIDKKNNTYRAIVTIAPYQKIPPSKVK-ADSLEGSLEQDPKFQEF--KVQRESYSQTASN 139

  Fly   160 DVKIDFNFERRTEEKVK-STPLLQYLANKKEKRREEARRRNEEKRKQREEQKLLRLAAQSDASKL 223
            |..|         ||:: |||||||||.||....|:.  :::..:|..:.:|.||||.       
pombe   140 DDVI---------EKLQTSTPLLQYLAEKKNAVVEKG--KSKPSKKSVKAKKKLRLAE------- 186

  Fly   224 KEAEGGGGGGDTKKPAKKDVKDP-QSSGSQANDAKASRSKRRTERDQRRREEHEQRKLVKRDKK- 286
            |.|......|.:.:.:||..|.| :|:.:...:.|.|                :::|..|:.|| 
pombe   187 KPASNNSKAGKSSQESKKSSKAPAESAAAVIKEDKVS----------------DRKKSKKKPKKT 235

  Fly   287 ----KDDGQGKQDKQDKQDKGKPSSGKQNKNSKSMD 318
                ....|..::..||:.|.|.|||||...||..|
pombe   236 PVSNSTASQASENASDKKTKEKKSSGKQKIASKKKD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Upf3NP_611844.3 Smg4_UPF3 27..186 CDD:281466 46/156 (29%)
upf3NP_593705.1 Smg4_UPF3 13..160 CDD:281466 47/158 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 68 1.000 Domainoid score I2719
eggNOG 1 0.900 - - E1_KOG1295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I1721
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002677
OrthoInspector 1 1.000 - - oto101786
orthoMCL 1 0.900 - - OOG6_104140
Panther 1 1.100 - - LDO PTHR13112
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1758
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.