DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP1 and dcp1

DIOPT Version :9

Sequence 1:NP_001163282.1 Gene:DCP1 / 37790 FlyBaseID:FBgn0034921 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_596662.1 Gene:dcp1 / 2541033 PomBaseID:SPBC3B9.21 Length:127 Species:Schizosaccharomyces pombe


Alignment Length:134 Identity:40/134 - (29%)
Similarity:63/134 - (47%) Gaps:27/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADESITR--MNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFF---------- 53
            |.||:|.|  :||..:|...|..:.|:|.:||||.|.|:....:|.||.:||.||          
pombe     1 MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVG 65

  Fly    54 --IYHRNAEPFHSIFINNRLNTTSFVEPITGSLELQSQPPFLLYRNERSRIRGFWFYNSEECDRI 116
              |.:||:.....:|||:..|           :.|..:  :|::|.|...:.|.|.::..:..||
pombe    66 YVILNRNSPENLYLFINHPSN-----------VHLVDR--YLIHRTENQHVVGLWMFDPNDMSRI 117

  Fly   117 SGLV 120
            ..:|
pombe   118 FNIV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP1NP_001163282.1 Dcp1 4..124 CDD:197362 38/131 (29%)
mRNA_decap_C 328..362 CDD:293346
dcp1NP_596662.1 Dcp1 6..125 CDD:197362 37/129 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I3200
eggNOG 1 0.900 - - E1_KOG2868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002778
OrthoInspector 1 1.000 - - oto102116
orthoMCL 1 0.900 - - OOG6_106417
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R298
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.