DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5597 and Skint1

DIOPT Version :10

Sequence 1:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001096132.1 Gene:Skint1 / 639781 MGIID:3649627 Length:364 Species:Mus musculus


Alignment Length:142 Identity:29/142 - (20%)
Similarity:47/142 - (33%) Gaps:33/142 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LDCDYEVEESPKFITVKW-----------YRDDKSIYQWIFGTPPYAIPEFRNEIDSTYESSTEP 97
            |.|.....:..:.:.::|           |||.|.::               .||.|.|...||.
Mouse    47 LSCQLSPPQQAQHMEIRWFRNLYTEPVHLYRDGKDMF---------------GEIISKYVERTEL 96

  Fly    98 SKQ-----YSSLALINPTIATTGDYKCVVQTSLNTFSSHQRVQVIDLRNYTLELS-HKTIHNETQ 156
            .|.     ..:|.:.|.|:...|.|.||.:.. :.:..|.....|...|..:::. |........
Mouse    97 LKDGIGEGKVTLRIFNVTVDDDGSYHCVFKDG-DFYEEHITEVKITAINLQVQIHVHPPNTKGVI 160

  Fly   157 LNCTVTNVYPRP 168
            :.|.....:|||
Mouse   161 VECHSGGWFPRP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5597NP_611841.1 None
Skint1NP_001096132.1 IGv domain 27..141 22/109 (20%)
IgV_MOG_like 28..141 CDD:409378 22/109 (20%)
FR1 28..51 CDD:409378 2/3 (67%)
Ig strand A 29..33 CDD:409378
Ig strand A' 36..40 CDD:409378
Ig strand B 43..51 CDD:409378 2/3 (67%)
CDR1 52..60 CDD:409378 0/7 (0%)
Ig strand C 60..65 CDD:409378 0/4 (0%)
FR2 61..65 CDD:409378 0/3 (0%)
CDR2 66..84 CDD:409378 4/32 (13%)
Ig strand C' 70..78 CDD:409378 1/7 (14%)
Ig strand C' 79..82 CDD:409378 1/2 (50%)
FR3 86..126 CDD:409378 13/39 (33%)
Ig strand D 93..98 CDD:409378 2/4 (50%)
Ig strand E 104..112 CDD:409378 1/7 (14%)
Ig strand F 119..127 CDD:409378 4/7 (57%)
CDR3 127..129 CDD:409378 0/2 (0%)
Ig strand G 129..141 CDD:409378 1/11 (9%)
FR4 130..141 CDD:409378 1/10 (10%)
IGc domain 142..228 6/31 (19%)
transmembrane domain 1 247..269
transmembrane domain 2 282..304
transmembrane domain 3 326..348
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.