DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5597 and beat-Ia

DIOPT Version :9

Sequence 1:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster


Alignment Length:159 Identity:41/159 - (25%)
Similarity:65/159 - (40%) Gaps:37/159 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EPTILDCDYEVEESPKFITVKWYRDDKSIYQWI-FGTPPYAIPEFRNEIDSTYESSTEPSKQYSS 103
            |..||.|.|::|:...: :||||:..:..|::. ..|||..:..|.. :.....||.|     |.
  Fly    42 EKAILKCFYDIEDDSLY-SVKWYKGRREFYRYTPKETPPMKVFHFPG-VKVRRVSSNE-----SQ 99

  Fly   104 LALINPTIATTGDYKCVVQT---SLNTFSSHQRVQVIDLRNYTLELSHKTIHNETQL-------- 157
            :.|...|:||:|.|.|.|..   |.:|..:...::||:           |.||...:        
  Fly   100 VVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELEVIE-----------TPHNAPFITGIRPRYR 153

  Fly   158 -------NCTVTNVYPRPTITIISNDMDV 179
                   |||..:..|...:|...|:.:|
  Fly   154 VGDILRGNCTSRHSRPAANLTWTVNNEEV 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5597NP_611841.1 None
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 26/82 (32%)
Ig 161..240 CDD:299845 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451087
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.