DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5597 and beat-Ic

DIOPT Version :9

Sequence 1:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001285970.1 Gene:beat-Ic / 34945 FlyBaseID:FBgn0028644 Length:534 Species:Drosophila melanogaster


Alignment Length:198 Identity:39/198 - (19%)
Similarity:68/198 - (34%) Gaps:55/198 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ILDCDYEVEESPKFITVKWYRDDKSIYQWIFGTPPYAIPEFRNEIDSTYESSTEPSKQYSSLALI 107
            :..|:|::|....: :||||:..:..|::   ||                      |:       
  Fly    75 LFTCNYDMENDTLY-SVKWYKGKREFYRY---TP----------------------KE------- 106

  Fly   108 NPTIATTGDYKCVVQTS-LNTFSSHQRVQVIDLRNYTLELSHKTIHNETQLNCTVTNVYPRPTIT 171
            ||.:      |....|| ||...:......:.|::..|.:|.|       ..|.::...|.....
  Fly   107 NPAM------KVFAMTSGLNVERNLSNQSHVVLQSVPLNISGK-------FTCEISVEAPTFQTA 158

  Fly   172 IISNDMDVVKREPMVYENEEGYFDGSAVVAAYDTDDDPDAYQCVVSFEGYGKNLTTVATSAAAGR 236
            ::|.:|:||       |..|.:...:.:.|.|...|..|. .|.:.:.....|||..........
  Fly   159 MVSGEMEVV-------ELPEEHTVVTGIQARYRIGDLVDG-NCSIKYSKPAANLTWTINGIVVPP 215

  Fly   237 SHV 239
            .|:
  Fly   216 HHI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5597NP_611841.1 None
beat-IcNP_001285970.1 Ig 189..>246 CDD:299845 6/31 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.