DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5597 and beat-Ib

DIOPT Version :9

Sequence 1:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001162987.1 Gene:beat-Ib / 34939 FlyBaseID:FBgn0028645 Length:327 Species:Drosophila melanogaster


Alignment Length:157 Identity:40/157 - (25%)
Similarity:69/157 - (43%) Gaps:20/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ILDCDYEVEESPKFITVKWYRDDKSIYQWI-FGTPPYAIPEFRNEID-STYESSTEPSKQYSSLA 105
            :|.|:|::|....: ||||||..:..|::. ...|.:.|....|||| .|.:|:.      |.:.
  Fly    47 LLICNYDIENDTLY-TVKWYRGRREFYRYTPKENPAWKIFTKTNEIDVETAQSNA------SHVL 104

  Fly   106 LINPTIATTGDYKCVVQTSLNTFSSH---QRVQVIDLRNYTLELSHKTIHNETQL------NCTV 161
            |.|...:.:|.:.|.|.....||.:.   ..::|::|......::  .||:..:|      ||:.
  Fly   105 LRNVPTSISGKFACEVSADAPTFDTSIVAADMEVVELPTQRPIIT--GIHSRYRLGDVINGNCSS 167

  Fly   162 TNVYPRPTITIISNDMDVVKREPMVYE 188
            ....|...:|...||:.|......:|:
  Fly   168 DYSKPAANLTWWINDIQVPPNYLRIYD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5597NP_611841.1 None
beat-IbNP_001162987.1 Ig 160..>182 CDD:299845 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.