DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5597 and sirpb1

DIOPT Version :10

Sequence 1:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_031748713.1 Gene:sirpb1 / 100496188 XenbaseID:XB-GENE-29083055 Length:852 Species:Xenopus tropicalis


Alignment Length:234 Identity:56/234 - (23%)
Similarity:109/234 - (46%) Gaps:47/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIAILAIGLLHRDALCYPTRDESEDKIIVLQNEEMEP----TILDCDYEVEE---SPKFITVKWY 62
            |:::|.:...|..||           .:.:..::..|    .:|.|.:.|:.   :|||:.:.|:
 Frog    13 LLSLLLLQHRHCSAL-----------EVTVPPDQSSPMGRDALLPCTFRVDNPPMNPKFLAILWH 66

  Fly    63 RDDKSIYQWIFGTPPYAIPEFRNEIDSTYESSTEPS--KQYSSLALINPTIATTGDYKCVVQTSL 125
            ..||.:.::          :.:.::.|...|..|.:  :..:||:|.|.|::..|.|:|.|    
 Frog    67 FGDKEVLRY----------DNKGKVSSPRVSIDERALLEGNASLSLSNVTVSDGGTYRCSV---- 117

  Fly   126 NTFSSHQRVQVIDLRNYTLE---LSHKT-IHNE-TQLNCTVTNVYP-RPTITIISNDMDVVKREP 184
             .:|...:.:.|.||.:.|.   ::.:| :.|: |.|.|:||:.|| |.|:|.:.|. .|:....
 Frog   118 -IYSPETQKKEIRLRIHALPEVVVAKRTLVRNQGTALRCSVTDFYPQRITVTWLRNG-KVLPNSA 180

  Fly   185 M--VYENEEGYF--DGSAVVAAYDTDDDPDAYQCVVSFE 219
            :  :.:|.:|.|  :.:..:...||:|.|: ..|:|..|
 Frog   181 LGPLQQNADGTFRLNSTLTLTPSDTEDTPE-IACLVQHE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5597NP_611841.1 None
sirpb1XP_031748713.1 V-set 30..133 CDD:462230 26/117 (22%)
C1-set 153..220 CDD:462221 21/68 (31%)
Ig 234..315 CDD:472250
Ig strand B 251..255 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 291..295 CDD:409353
Ig strand F 302..310 CDD:409353
IgC1 <617..702 CDD:409354
Ig strand C 626..632 CDD:409354
Ig strand C' 639..640 CDD:409354
Ig strand D 648..658 CDD:409354
Ig strand E 665..673 CDD:409354
Ig strand F 684..691 CDD:409354
Ig strand G 699..702 CDD:409354
Ig 701..804 CDD:472250
Ig strand B 712..716 CDD:409353
Ig strand C 736..740 CDD:409353
Ig strand E 771..782 CDD:409353
Ig strand F 789..793 CDD:409353
Ig strand G 801..804 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.