DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and HAT22

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_195493.1 Gene:HAT22 / 829935 AraportID:AT4G37790 Length:278 Species:Arabidopsis thaliana


Alignment Length:191 Identity:38/191 - (19%)
Similarity:81/191 - (42%) Gaps:37/191 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GLSVANHINHYNLMIDSS-----YKLCANESAIRGSLNQESSLLFS------KITTVSEFYPATH 85
            ||.::...|:||..|..|     ::....:.::..||:.||..:.:      :|...:..:....
plant    14 GLGLSPTPNNYNHAIKKSSSTVDHRFIRLDPSLTLSLSGESYKIKTGAGAGDQICRQTSSHSGIS 78

  Fly    86 NIGSYNTDFHLKSYGDDGLSLTDKSKQRRIRTTFTSN-------------QLNELEKIFLETHYP 137
            :..|.......:..|.||....:::.:|.:.:..:.:             :|.:.:...||.::.
plant    79 SFSSGRVKREREISGGDGEEEAEETTERVVCSRVSDDHDDEEGVSARKKLRLTKQQSALLEDNFK 143

  Fly   138 DIYT-----REEIASKLHLTEARVQVWFQNRRA--KFRKQERHAIYIMK------DKSSKL 185
            ...|     ::.:|.:|:|...:|:||||||||  |.::.|....::.|      |::.:|
plant   144 LHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 17/71 (24%)
HAT22NP_195493.1 Homeobox 129..179 CDD:278475 16/49 (33%)
HALZ 181..224 CDD:128634 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.