DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and HAT1

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_193476.1 Gene:HAT1 / 827457 AraportID:AT4G17460 Length:282 Species:Arabidopsis thaliana


Alignment Length:139 Identity:38/139 - (27%)
Similarity:61/139 - (43%) Gaps:25/139 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GDDGLSLT-DKSKQR--------------RIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKL 149
            ||| |.:| |:|..|              |.:...:.:|...||..|.|.:..:...:..:|.||
plant   106 GDD-LDITLDRSSSRGTSDEEEDYGGETCRKKLRLSKDQSAVLEDTFKEHNTLNPKQKLALAKKL 169

  Fly   150 HLTEARVQVWFQNRRA--KFRKQERHAIYI------MKDKSSKLDGRKNPVAGSKYLGPSLKGPQ 206
            .||..:|:||||||||  |.::.|....|:      :.:::.:|:.....:...| |.|.|.|..
plant   170 GLTARQVEVWFQNRRARTKLKQTEVDCEYLKRCVEKLTEENRRLEKEAAELRALK-LSPRLYGQM 233

  Fly   207 NGHGRQMKC 215
            :.....:.|
plant   234 SPPTTLLMC 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 20/53 (38%)
HAT1NP_193476.1 HD-ZIP_N 8..98 CDD:282474
HOX 134..188 CDD:197696 20/53 (38%)
HALZ 190..233 CDD:128634 8/43 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.