DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and HAT3

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_191598.1 Gene:HAT3 / 825210 AraportID:AT3G60390 Length:315 Species:Arabidopsis thaliana


Alignment Length:163 Identity:40/163 - (24%)
Similarity:72/163 - (44%) Gaps:29/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SSYKLCANESAIRGSLNQESSLLFSKITTVSEFYPATHNIGSYNTDFHLKSYGDDGLSLTDKSKQ 112
            |..:|.|...|:.|...::           :|...|:.::|..:.|       :||....|.|.:
plant   115 SERELMAAAGAVGGGRVED-----------NEIERASCSLGGGSDD-------EDGSGNGDDSSR 161

  Fly   113 RRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRA--KFRKQERHAI 175
            :::|  .:..|...||:.|.|....:...:..:|.:|:|...:|:||||||||  |.::.|....
plant   162 KKLR--LSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTKLKQTEVDCE 224

  Fly   176 YI------MKDKSSKLDGRKNPVAGSKYLGPSL 202
            |:      :.|::.:|....:.:...| |.|.|
plant   225 YLKRCCENLTDENRRLQKEVSELRALK-LSPHL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 19/53 (36%)
HAT3NP_191598.1 HD-ZIP_N 19..118 CDD:398351 1/2 (50%)
Homeobox 165..215 CDD:395001 18/51 (35%)
HALZ 217..260 CDD:128634 8/41 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.