DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and HB4

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_182018.1 Gene:HB4 / 819100 AraportID:AT2G44910 Length:318 Species:Arabidopsis thaliana


Alignment Length:200 Identity:47/200 - (23%)
Similarity:81/200 - (40%) Gaps:43/200 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TANSEF---YNSGANGGGLSVANHINHYNLMIDSSYKLCANE------SAIRG-SLNQ-ESSL-- 69
            :::|.|   :|...|.....:.| |:..:|...|..|....|      |.:|| ::|: :||:  
plant    35 SSSSSFQHMHNQNNNSHPQKIHN-ISWTHLFQSSGIKRTTAERNSDAGSFLRGFNVNRAQSSVAV 98

  Fly    70 --LFSKITTVSEFYPATHNIGSYNTDFHLKSYGD---------------------DGLSLTDKSK 111
              |..:...||....|..::.....|..:...||                     ||.:.....|
plant    99 VDLEEEAAVVSSPNSAVSSLSGNKRDLAVARGGDENEAERASCSRGGGSGGSDDEDGGNGDGSRK 163

  Fly   112 QRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRA--KFRKQERHA 174
            :.|:    :.:|...||:.|.|....:...:..:|.:|:|...:|:||||||||  |.::.|...
plant   164 KLRL----SKDQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTKLKQTEVDC 224

  Fly   175 IYIMK 179
            .|:.:
plant   225 EYLKR 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 18/53 (34%)
HB4NP_182018.1 HD-ZIP_N 8..124 CDD:398351 20/89 (22%)
Homeobox 166..216 CDD:395001 18/53 (34%)
HALZ 218..261 CDD:128634 2/11 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.