Sequence 1: | NP_523834.1 | Gene: | PHDP / 37788 | FlyBaseID: | FBgn0025334 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_182018.1 | Gene: | HB4 / 819100 | AraportID: | AT2G44910 | Length: | 318 | Species: | Arabidopsis thaliana |
Alignment Length: | 200 | Identity: | 47/200 - (23%) |
---|---|---|---|
Similarity: | 81/200 - (40%) | Gaps: | 43/200 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 TANSEF---YNSGANGGGLSVANHINHYNLMIDSSYKLCANE------SAIRG-SLNQ-ESSL-- 69
Fly 70 --LFSKITTVSEFYPATHNIGSYNTDFHLKSYGD---------------------DGLSLTDKSK 111
Fly 112 QRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRA--KFRKQERHA 174
Fly 175 IYIMK 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PHDP | NP_523834.1 | Homeobox | 116..168 | CDD:278475 | 18/53 (34%) |
HB4 | NP_182018.1 | HD-ZIP_N | 8..124 | CDD:398351 | 20/89 (22%) |
Homeobox | 166..216 | CDD:395001 | 18/53 (34%) | ||
HALZ | 218..261 | CDD:128634 | 2/11 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |