DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and crx

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_694419.1 Gene:crx / 81881 ZFINID:ZDB-GENE-010403-1 Length:281 Species:Danio rerio


Alignment Length:89 Identity:43/89 - (48%)
Similarity:58/89 - (65%) Gaps:15/89 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 YGDDGLSLTDKS---------------KQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASK 148
            |..:||:|:...               ||||.|||||..||:.||.:|.:|.||||:.|||:|.|
Zfish    10 YAVNGLTLSASGMDLLHTAVGYPATPRKQRRERTTFTRTQLDILEALFTKTRYPDIFMREEVALK 74

  Fly   149 LHLTEARVQVWFQNRRAKFRKQER 172
            ::|.|:||||||:|||||.|:|::
Zfish    75 INLPESRVQVWFKNRRAKCRQQQQ 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 35/55 (64%)
crxNP_694419.1 homeodomain 38..97 37/58 (64%)
Homeodomain 49..94 CDD:459649 28/44 (64%)
TF_Otx 152..230 CDD:427350
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.