DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Rhox13

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001171931.1 Gene:Rhox13 / 73614 MGIID:1920864 Length:232 Species:Mus musculus


Alignment Length:54 Identity:29/54 - (53%)
Similarity:38/54 - (70%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 FTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQER 172
            |...|:.|:|.:|.||.|||:.||.|:|..|::.|.:|:|||.|||||.||.||
Mouse   155 FAQWQVEEMESLFEETQYPDLLTRGELARTLNVPEVKVKVWFTNRRAKQRKIER 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 25/49 (51%)
Rhox13NP_001171931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..114
Homeodomain 155..205 CDD:459649 25/49 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.