DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Vsx1

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001103016.1 Gene:Vsx1 / 689704 RGDID:1305667 Length:369 Species:Rattus norvegicus


Alignment Length:181 Identity:61/181 - (33%)
Similarity:82/181 - (45%) Gaps:56/181 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 THNIGSYNTDFHLKSYGDDGLSLT-DKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIAS 147
            :.||.:.:.|...:...|..:||| .|.|:||.||.||::||.||||.|.|.||||:|.||.:|.
  Rat   139 SENISTSDGDSPSEEKNDPKMSLTLGKRKKRRHRTVFTAHQLEELEKAFGEAHYPDVYAREMLAV 203

  Fly   148 KLHLTEARVQVWFQNRRAKFRKQE-------------------RHAIYI---------------- 177
            |..|.|.|:||||||||||:||:|                   ||.|.:                
  Rat   204 KTELPEDRIQVWFQNRRAKWRKREKRWGGSSVMAEYGLYGAMVRHCIPLPDSVLNSADSLQGSCA 268

  Fly   178 -----MKDKSSKLDGRKNPVAGSKYLG------------PSLKGPQNGHGR 211
                 |..||:::   :.|.:..|..|            ....||:.|.|:
  Rat   269 PWLLGMHKKSTEM---RKPESEEKLAGLWELDHLRKGAKKDEDGPERGPGK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 34/51 (67%)
Vsx1NP_001103016.1 Homeobox 171..224 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.