DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Isx

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_008770554.1 Gene:Isx / 682968 RGDID:1592776 Length:242 Species:Rattus norvegicus


Alignment Length:161 Identity:60/161 - (37%)
Similarity:80/161 - (49%) Gaps:37/161 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IDSSYKLCANESAIRGSLNQESSLLFSKITTVSEFYPATHNIGSYNTDFHLKSYGDDGLSLTDKS 110
            |:.|...|.....:..|.:.|:.|   |..|.....|...:||.          ||...:.|..|
  Rat    10 IEKSSGYCEAPEKLGLSFSIEAIL---KRPTERRNLPRPQSIGG----------GDSRQTTTSGS 61

  Fly   111 K---------------QRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWF 160
            |               :||:|||||:.||.||||:|..||||||:.|.::||:::|.|||||:||
  Rat    62 KLEKPTQDQPQEERKNKRRVRTTFTTEQLQELEKLFHFTHYPDIHVRSQLASRINLPEARVQIWF 126

  Fly   161 QNRRAKFRKQERHAIYIMKDKSSKLDGRKNP 191
            ||:|||:||||         ||..|...:.|
  Rat   127 QNQRAKWRKQE---------KSGSLSAPQQP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 34/51 (67%)
IsxXP_008770554.1 Homeobox 82..134 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.