DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and SHOX2

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_003021.3 Gene:SHOX2 / 6474 HGNCID:10854 Length:355 Species:Homo sapiens


Alignment Length:80 Identity:49/80 - (61%)
Similarity:58/80 - (72%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LKSYGDDGLSLTD----KSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARV 156
            ||...:|...:.|    |.||||.||.||..||||||::|.||||||.:.|||::.:|.|:||||
Human   144 LKDRKEDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARV 208

  Fly   157 QVWFQNRRAKFRKQE 171
            ||||||||||.||||
Human   209 QVWFQNRRAKCRKQE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 38/55 (69%)
SHOX2NP_003021.3 Homeodomain 165..221 CDD:459649 38/55 (69%)
OAR 335..351 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.