DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and DRGX

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_011538391.1 Gene:DRGX / 644168 HGNCID:21536 Length:298 Species:Homo sapiens


Alignment Length:146 Identity:58/146 - (39%)
Similarity:73/146 - (50%) Gaps:52/146 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 THNIGSYNT-DFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIAS 147
            |...|:::: ||      |||..   :.||||.|||||..||..||.:|.:|||||::||||:|.
Human    13 TATFGNHSSGDF------DDGFL---RRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAM 68

  Fly   148 KLHLTEARVQ-----------------------------------VWFQNRRAKFRKQERHAIYI 177
            |::|||||||                                   |||||||||:||.||.|   
Human    69 KINLTEARVQLANSCLKTELQIEINDTIIEHSEVEDHNFSLKGARVWFQNRRAKWRKTERGA--- 130

  Fly   178 MKDKSSKLDGRKNPVA 193
                |.:..|.|.|:|
Human   131 ----SDQEPGAKEPMA 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 37/86 (43%)
DRGXXP_011538391.1 Homeobox 37..124 CDD:278475 37/86 (43%)
OAR 236..252 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3133
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.