DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and otx2

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_012823826.1 Gene:otx2 / 548931 XenbaseID:XB-GENE-485220 Length:306 Species:Xenopus tropicalis


Alignment Length:136 Identity:52/136 - (38%)
Similarity:69/136 - (50%) Gaps:44/136 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 HLKS--YGDDGLSLTDKS--------------------------------KQRRIRTTFTSNQLN 125
            :||.  |..:|||||...                                ||||.|||||..||:
 Frog     4 YLKQPPYAVNGLSLTTSGMDLLHPSVGYPVALHQSRQITCSFYDFAATPRKQRRERTTFTRAQLD 68

  Fly   126 ELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKN 190
            .||.:|.:|.||||:.|||:|.|::|.|:||||||:|||||.|:|::          .:.:|.:|
 Frog    69 VLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ----------QQQNGGQN 123

  Fly   191 PVAGSK 196
            .|..||
 Frog   124 KVRPSK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 35/55 (64%)
otx2XP_012823826.1 Homeodomain 56..111 CDD:459649 35/54 (65%)
TF_Otx 170..251 CDD:427350
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.