| Sequence 1: | NP_523834.1 | Gene: | PHDP / 37788 | FlyBaseID: | FBgn0025334 | Length: | 220 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_012823826.1 | Gene: | otx2 / 548931 | XenbaseID: | XB-GENE-485220 | Length: | 306 | Species: | Xenopus tropicalis |
| Alignment Length: | 136 | Identity: | 52/136 - (38%) |
|---|---|---|---|
| Similarity: | 69/136 - (50%) | Gaps: | 44/136 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 95 HLKS--YGDDGLSLTDKS--------------------------------KQRRIRTTFTSNQLN 125
Fly 126 ELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKN 190
Fly 191 PVAGSK 196 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| PHDP | NP_523834.1 | Homeodomain | 113..169 | CDD:459649 | 35/55 (64%) |
| otx2 | XP_012823826.1 | Homeodomain | 56..111 | CDD:459649 | 35/54 (65%) |
| TF_Otx | 170..251 | CDD:427350 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||