DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and phox2bb

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001014818.1 Gene:phox2bb / 544654 ZFINID:ZDB-GENE-050407-3 Length:284 Species:Danio rerio


Alignment Length:226 Identity:88/226 - (38%)
Similarity:110/226 - (48%) Gaps:56/226 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YNLMIDSSYKLC---------ANESAIRGSLNQESSLLFSKITTV-------SEFYPATHNIGSY 90
            |:.:..|:|:.|         |:..|...|.:|.|...::.|.|.       ....|.:.::|:.
Zfish     6 YSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTL 70

  Fly    91 NTDFH---------LKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIA 146
            ..  |         .|.:.|.| .|.:|.|||||||||||.||.|||::|.||||||||||||:|
Zfish    71 RD--HQSSPYAAVPYKLFTDHG-GLNEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELA 132

  Fly   147 SKLHLTEARVQVWFQNRRAKFRKQERHAIYI---------MKDKSSKLDGRK------------- 189
            .|:.||||||||||||||||||||||.|...         .|..|.:.|.::             
Zfish   133 LKIDLTEARVQVWFQNRRAKFRKQERAAAAAAAAAKNGTGKKSDSREEDSKEAKATDPDSTGGPG 197

  Fly   190 -NPVAGSKYLGPSLKGPQ-----NGHGRQMK 214
             ||...|...|||..|.|     ||...|:|
Zfish   198 PNPNPTSNCGGPSPTGGQVSATGNGPVEQVK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 42/51 (82%)
phox2bbNP_001014818.1 Homeobox 102..154 CDD:278475 42/51 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6734
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1505098at2759
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm24212
orthoMCL 1 0.900 - - OOG6_109475
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3133
SonicParanoid 1 1.000 - - X2223
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.