DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Pitx2

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001035970.1 Gene:Pitx2 / 54284 RGDID:3331 Length:324 Species:Rattus norvegicus


Alignment Length:65 Identity:42/65 - (64%)
Similarity:50/65 - (76%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 KSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQERH 173
            |.:|||.||.|||.||.|||..|....|||:.||||||...:||||||:|||:|||||:||:||:
  Rat    89 KKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERN 153

  Fly   174  173
              Rat   154  153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 36/55 (65%)
Pitx2NP_001035970.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..111 14/21 (67%)
Homeodomain 93..149 CDD:459649 36/55 (65%)
OAR 282..299 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 286..299
Nuclear localization signal. /evidence=ECO:0000255 292..296
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.