powered by:
Protein Alignment PHDP and alx4b
DIOPT Version :9
Sequence 1: | NP_523834.1 |
Gene: | PHDP / 37788 |
FlyBaseID: | FBgn0025334 |
Length: | 220 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001297007.1 |
Gene: | alx4b / 497424 |
ZFINID: | ZDB-GENE-050208-140 |
Length: | 259 |
Species: | Danio rerio |
Alignment Length: | 62 |
Identity: | 12/62 - (19%) |
Similarity: | 27/62 - (43%) |
Gaps: | 13/62 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 SEFYNSGANGGGLS------------VANHINHYNLMIDSSYKLCANESAIRGSLNQESSLL 70
|:|....:.||.:: |...||.|:|.::...| .::.:::|....:.|:.:
Zfish 195 SDFLGMPSPGGSMAQTHMGSLFGSSGVGGTINGYDLSVEPDRK-SSSIASLRMKAKEHSAAI 255
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
PHDP | NP_523834.1 |
Homeobox |
116..168 |
CDD:278475 |
|
alx4b | NP_001297007.1 |
OAR |
235..252 |
CDD:281777 |
2/17 (12%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.