DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and repo

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster


Alignment Length:189 Identity:64/189 - (33%)
Similarity:89/189 - (47%) Gaps:48/189 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GGGLSVANHINHYN--LMIDSSYKLCANESAIRGSLNQESSLL-------------FSKITTVSE 79
            ||.....:|::|.:  |:.||| .:..|..:..|.|.:...:.             .|..|.|: 
  Fly   190 GGSPHHLDHLDHGSDGLLQDSS-PVMINGGSAGGKLKKPDEMCSQLEAGGAGVTPPSSSSTVVN- 252

  Fly    80 FYPATHNIGSYNTDFHLKSYG-------------------DDGLSLTDKS-----KQRRIRTTFT 120
              ..|:..|:.|:.   .|.|                   .||.|...|.     |:::.|||||
  Fly   253 --GTTNGTGNANSS---SSAGVGIQGAAGTAGGVAAPAAKKDGSSSKKKGDPNGIKKKKTRTTFT 312

  Fly   121 SNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQE--RHAIYI 177
            :.||.|||:.|....|||::.|||:|.||:|:|:||||||||||||:||.|  |...||
  Fly   313 AYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHEPPRKTGYI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 34/51 (67%)
repoNP_477026.1 Homeobox 313..360 CDD:278475 29/46 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.