DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and si:dkey-43p13.5

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_002661267.2 Gene:si:dkey-43p13.5 / 407678 ZFINID:ZDB-GENE-131121-510 Length:315 Species:Danio rerio


Alignment Length:105 Identity:46/105 - (43%)
Similarity:61/105 - (58%) Gaps:7/105 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQERHAI 175
            ||||.|..::|.||.||||.|..||||||:.||.:|.:|.|.||||||||||||||.|:|.:..|
Zfish   140 KQRRARANYSSWQLEELEKTFQSTHYPDIFMREALALRLDLIEARVQVWFQNRRAKMRRQLKLQI 204

  Fly   176 YIMKDKSSKLDGRKNPVAGSKYLGPSLKGPQNGHGRQMKC 215
            ...:..|.:....::|.:       |:..|:..:.....|
Zfish   205 QTGEQCSQRDTDTRHPES-------SISNPELHNNSPSPC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 34/51 (67%)
si:dkey-43p13.5XP_002661267.2 Homeobox 145..197 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.