DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and PHOX2A

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_005160.2 Gene:PHOX2A / 401 HGNCID:691 Length:284 Species:Homo sapiens


Alignment Length:177 Identity:73/177 - (41%)
Similarity:95/177 - (53%) Gaps:28/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEFSLLNKANFDKDCLYTANSEFYNS-GA--NGGGLSVANHINHYNLMIDSSYKLCANESAIRGS 62
            |::|.||  ::| .|:....:..|.. ||  ..||...:        .:..::..........||
Human     1 MDYSYLN--SYD-SCVAAMEASAYGDFGACSQPGGFQYS--------PLRPAFPAAGPPCPALGS 54

  Fly    63 LNQESSLLFSKITTVSEFYPATHNIGSYNTDFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNEL 127
            .|       ..:..:.:..||.::...|       .:..:...|.:|.|||||||||||.||.||
Human    55 SN-------CALGALRDHQPAPYSAVPY-------KFFPEPSGLHEKRKQRRIRTTFTSAQLKEL 105

  Fly   128 EKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQERHA 174
            |::|.||||||||||||:|.|:.||||||||||||||||||||||.|
Human   106 ERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAA 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 42/51 (82%)
PHOX2ANP_005160.2 Homeobox 94..147 CDD:365835 43/52 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..284 7/8 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6854
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1505098at2759
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm40710
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3133
SonicParanoid 1 1.000 - - X2223
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.