DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Rhox12

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001020254.1 Gene:Rhox12 / 382282 MGIID:2685994 Length:186 Species:Mus musculus


Alignment Length:174 Identity:50/174 - (28%)
Similarity:73/174 - (41%) Gaps:39/174 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YKLCANESAIR------------------GSLNQESSLLFSKITTVSE---FYPATHNIGS-YNT 92
            |||..||..:.                  ||||....|....|....:   :.....|||: ...
Mouse    13 YKLGENEIEVTLDADQEADGAAEGGSFGDGSLNGSDKLKCQGIPDDKDDVIYVGELKNIGNDIKD 77

  Fly    93 DFHLKSYGDDGLSLTDKSK-------------QRRIRTTFTSNQLNELEKIFLETHYPDIYTREE 144
            :.|....|.......:|.|             :.||:..||..||||||..|.:|.|||..||:.
Mouse    78 ECHGSHQGSGDPQPEEKQKNSAAARVPQVRRTRPRIQLGFTPRQLNELEDFFEKTKYPDALTRKN 142

  Fly   145 IASKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGR 188
            :|..|:|.|::||.||:.|||.:||:::..:.    :.:..||:
Mouse   143 LAKHLYLAESKVQRWFKKRRAHYRKEQQSQVL----QCASADGQ 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 26/51 (51%)
Rhox12NP_001020254.1 homeodomain 107..169 CDD:238039 30/61 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.