DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Rx

DIOPT Version :10

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_726006.3 Gene:Rx / 37367 FlyBaseID:FBgn0020617 Length:904 Species:Drosophila melanogaster


Alignment Length:152 Identity:65/152 - (42%)
Similarity:86/152 - (56%) Gaps:22/152 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EFYNSGANGGGLSVANHINHYNLMIDSSYKLCANESAIRGSLNQ-ESSLLFSKITTVSEFYPATH 85
            :|.||| ||.....:|..:|...:...|..|.....|....||| .||....|||:.|:      
  Fly   489 DFRNSG-NGNPNGNSNSGDHGERLNADSDSLVNGSCASSEDLNQTNSSEQGEKITSGSD------ 546

  Fly    86 NIGSYNTDFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLH 150
            :.|.           ||..:   |.|.||.|||||:.||:|||:.|.::||||:|:|||:|.|::
  Fly   547 DEGQ-----------DDNCA---KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVN 597

  Fly   151 LTEARVQVWFQNRRAKFRKQER 172
            |.|.||||||||||||:|:||:
  Fly   598 LPEVRVQVWFQNRRAKWRRQEK 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 37/55 (67%)
RxNP_726006.3 Homeodomain 560..616 CDD:459649 37/55 (67%)
OAR 876..892 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.